Login Register
English
0

Cart

$ 0

Mouse IL-7 Protein, His tag (Animal-Free)

Mouse IL-7 Protein, His tag (Animal-Free)

Views(159) Publications(0) Catalog no(PRP1164)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse IL-7 Protein, His tag (Animal-Free)
Sequence MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus.
Activity Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 10⁶ IU/mg.
Protein length The protein has a calculated MW of 15.8 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Lymphopoietin 1(LP-1), pre-B-cell factor, hlb368, A630026I06Rik

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 15.8 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Mouse IL-7 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma.
Alternative Lymphopoietin 1(LP-1), pre-B-cell factor, hlb368, A630026I06Rik
Accession P10168

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse IL-7 Protein, His tag (Animal-Free)”