Login Register
English
0

Cart

$ 0

Human HMGB1 Protein, His tag (Animal-Free)

Human HMGB1 Protein, His tag (Animal-Free)

Views(225) Publications(0) Catalog no(PRP1092)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human HMGB1 Protein, His tag (Animal-Free)
Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL.
Protein length The protein has a calculated MW of 25.70 kDa. The protein migrates as 35 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative HMG-1, HMG1, HMG3, SBP-1

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 25.70 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human HMGB1 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background High mobility group protein B1 protein (HMGB1) is the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 25 kDa single chain polypeptide containing three domains: two N-terminal HMG boxes A and B, and a negatively charged 30 aa C-terminal region that contains only Asp and Glu. Post-translational modification on HMGB1 have been reported, affect its localization, receptor interactions, and function. HMGB1, with a disulfide bond between C23 and C45, that cause cytokine production and the activation of NF-κB. Otherwise, the fully oxidized form has no immune function, losing its proinflammatory effect and the apoptotic cell death activation function.
Alternative HMG-1, HMG1, HMG3, SBP-1
Accession P09429

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human HMGB1 Protein, His tag (Animal-Free)”