Login Register
English
0

Cart

$ 0

Human G-CSF Protein, His tag (Animal-Free)

Human G-CSF Protein, His tag (Animal-Free)

Views(108) Publications(0) Catalog no(PRP1093)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human G-CSF Protein, His tag (Animal-Free)
Sequence TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.
Activity Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant human G-CSF is > 2 x 10⁷ IU/mg.
Protein length The protein has a calculated MW of 19.48 kDa. The protein migrates as 21kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative CSF-3, MGI-1G, GM-CSF beta, pluripoietin

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 19.48 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human G-CSF Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment also is an established useful clinical agent for increasing neutrophilic granulocytes levels. G-CSF is a 18.67 kDa protein having 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, development of myeloid cells.
Alternative CSF-3, MGI-1G, GM-CSF beta, pluripoietin
Accession NP_757373

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human G-CSF Protein, His tag (Animal-Free)”