Login Register
English
0

Cart

$ 0

Human FGF-21 Protein, His tag (Animal-Free)

Human FGF-21 Protein, His tag (Animal-Free)

Views(208) Publications(0) Catalog no(PRP1094)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human FGF-21 Protein, His tag (Animal-Free)
Sequence MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED₅₀ for this effect is <0.4 μg/mL.
Protein length The protein has a calculated MW of 20.35 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative FGFL

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 20.35 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human FGF-21 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Fibroblast Growth Factors-21 (FGF-21) is a 22.3 kDa member of the fibroblast Growth Factors with 209 amino acid residues. FGF-21 is expressed from liver and cardiomyocytes. FGF-21 is a key protein that regulates important metabolic pathways, and modulates cellular function, metabolism, and senescence. It can stimulate glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1 /GLUT1 expression.
Alternative FGFL
Accession Q9NSA1

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human FGF-21 Protein, His tag (Animal-Free)”