Login Register
English
0

Cart

$ 0

Human CXCL10 Protein, His tag (Animal-Free)

Human CXCL10 Protein, His tag (Animal-Free)

Views(247) Publications(0) Catalog no(PRP1097)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human CXCL10 Protein, His tag (Animal-Free)
Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP with polyhistidine tag at the N-terminus.
Activity Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.
Protein length The protein has a calculated MW of 9.45 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative IP-10, Gamma-Interferon Inducible Protein 10, Crg-2

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 9.45 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human CXCL10 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responded for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induce the cell migration and activation like T cells and dendritic cells.
Alternative IP-10, Gamma-Interferon Inducible Protein 10, Crg-2
Accession P02778

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human CXCL10 Protein, His tag (Animal-Free)”