Login Register
English
0

Cart

$ 0

Human BMP-15 Protein, His tag (Animal-Free)

Human BMP-15 Protein, His tag (Animal-Free)

Views(235) Publications(0) Catalog no(PRP1911)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human BMP-15 Protein, His tag (Animal-Free)
Sequence MQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR with polyhistidinetag at the C- terminus
Activity Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <17 ng/mL.
Protein length The protein has a calculated MW of 14.88 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Growth/Differentiation Factor-9B, GDF-9B, ODG2, POF4

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 14.88 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human BMP-15 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Bone Morphogenetic Protein-15 (BMP-15) is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. In the ovarian follicles, BMP-15 has a vital role in regulating the growth and maturation of follicles, the sensitivity of granulosa cells to FSH, and preventing granulosa cells from apoptosis. In addition, BMP-15 and GDF9 cooperate and have the same interaction on target cells.
Alternative Growth/Differentiation Factor-9B, GDF-9B, ODG2, POF4
Accession O95972

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human BMP-15 Protein, His tag (Animal-Free)”