| Product name | Human SCF Protein, His tag (Animal-Free) |
| Sequence | MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus |
| Activity | Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 10⁵ IU/mg. |
| Protein length | The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis). |
| Preparation method | E. coli |
| Purity | >98% as determined by SDS-PAGE. |
| Alternative | DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand |
| Formulation | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Features & Benefits | Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method. |
| Molecular weight | 19.4 kDa |
| Usage notes | Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human SCF Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage instructions | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Shipping | The product is shipped with blue ice. |
| Precautions | The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product. |
| Background | Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other Growth Factorss, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells. |
| Alternative | DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand |
| Accession | P21583 |
You must be logged in to post a review.
1.The species of antibody reactivity should be the sample species that can be matched normally after Abbkine R&D experts have passed strict scientific verification. If your sample is not within the range of reactivity, in order to improve the efficiency and results of your experiment, it is not suggested to try other species. Otherwise, it may lead to sample mismatch and affect the effect of your experiment.
2.Please aliquot the antibody received as soon as possible and store it at -20℃, avoid repeated freezing and thawing, and use it within one year.
Welcome any form of communications, and better service will be provided here.
Tell： +1-404-854-0155
Email： service@abbkine.com
Support Email： support@abbkine.com
Address： 3052 Stroop Hill Road, Apt 203, Atlanta 30303, Georgia, United States of America
Reviews
There are no reviews yet.